Cytokeratin 18 antibody (70R-1405)

Rabbit polyclonal Cytokeratin 18 antibody raised against the C terminal of KRT18

Synonyms Polyclonal Cytokeratin 18 antibody, Anti-Cytokeratin 18 antibody, Cytokeratin -18, Cytokeratin 18, Cytokeratin 18 antibody, CK18 antibody, Cytokeratin -18 antibody, KRT18 antibody, Keratin 18 antibody, Cytokeratin 18, K18 antibody
Specificity Cytokeratin 18 antibody was raised against the C terminal of KRT18
Cross Reactivity Human
Applications IHC, WB
Immunogen Cytokeratin 18 antibody was raised using the C terminal of KRT18 corresponding to a region with amino acids ALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIV
Assay Information Cytokeratin 18 Blocking Peptide, catalog no. 33R-1352, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 18 antibody


Immunohistochemical staining using Cytokeratin 18 antibody (70R-1405)

Cytokeratin 18 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KRT18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KRT18 (Keratin 18) is type I intermediate filament chain. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial tissues of the body. Mutations in this gene have been linked to cryptogenic cirrhosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using Cytokeratin 18 antibody (70R-1405) | Cytokeratin 18 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
  • Western Blot analysis using Cytokeratin 18 antibody (70R-1405) | Cytokeratin 18 antibody (70R-1405) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $315.00
Size: 100 ug
View Our Distributors