Cytokeratin 222 Pseudogene antibody (70R-4160)

Rabbit polyclonal Cytokeratin 222 Pseudogene antibody raised against the N terminal of KRT222P

Synonyms Polyclonal Cytokeratin 222 Pseudogene antibody, Anti-Cytokeratin 222 Pseudogene antibody, Cytokeratin -222 antibody, MGC45562 antibody, KRT222P antibody, Cytokeratin -222, KA21 antibody, Cytokeratin 222, Cytokeratin 222, Cytokeratin 222 antibody, Keratin 222 Pseudogene antibody
Specificity Cytokeratin 222 Pseudogene antibody was raised against the N terminal of KRT222P
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Cytokeratin 222 Pseudogene antibody was raised using the N terminal of KRT222P corresponding to a region with amino acids ELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAA
Assay Information Cytokeratin 222 Pseudogene Blocking Peptide, catalog no. 33R-2575, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 222 Pseudogene antibody

Images

Western Blot analysis using Cytokeratin 222 Pseudogene antibody (70R-4160)

Cytokeratin 222 Pseudogene antibody (70R-4160) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KRT222P antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KRT222P belongs to the intermediate filament family. The exact function of KRT222P is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Cytokeratin 222 Pseudogene antibody (70R-4160) | Cytokeratin 222 Pseudogene antibody (70R-4160) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors