Cytokeratin 8 antibody (70R-3292)

Rabbit polyclonal Cytokeratin 8 antibody raised against the N terminal of KRT8

Synonyms Polyclonal Cytokeratin 8 antibody, Anti-Cytokeratin 8 antibody, Cytokeratin 8 antibody, CYK8 antibody, Cytokeratin -8 antibody, K2C8 antibody, KO antibody, Cytokeratin -8, CK8 antibody, Cytokeratin 8, Cytokeratin 8, KRT8 antibody, CARD2 antibody, Keratin 8 antibody, K8 antibody
Specificity Cytokeratin 8 antibody was raised against the N terminal of KRT8
Cross Reactivity Human
Applications IHC, WB
Immunogen Cytokeratin 8 antibody was raised using the N terminal of KRT8 corresponding to a region with amino acids MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL
Assay Information Cytokeratin 8 Blocking Peptide, catalog no. 33R-6446, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 8 antibody

Images

Immunohistochemical staining using Cytokeratin 8 antibody (70R-3292)

Cytokeratin 8 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KRT8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KRT8 together with KRT19, help to link the contractile apparatus to dystrophin at the costameres of striated muscle.

References
Add a Paper

Joan Oliva, Fawzia Bardag-Gorce, Andrew Lin, Barbara A. French, Samuel W. French

The role of cytokines in UbD promoter regulation and Mallory-Denk body-like aggresomes

Experimental and Molecular Pathology

Volume: 89 Issue: 1 Page: 1-8 DOI: 10.1016/j.yexmp.2010.04.001

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using Cytokeratin 8 antibody (70R-3292) | Cytokeratin 8 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using Cytokeratin 8 antibody (70R-3292) | Cytokeratin 8 antibody (70R-3292) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors