D15WSU75E antibody (70R-3435)

Rabbit polyclonal D15WSU75E antibody raised against the middle region of D15Wsu75E

Synonyms Polyclonal D15WSU75E antibody, Anti-D15WSU75E antibody, DWSU75E-15, D15WSU75E, DJ347H13.4 antibody, MGC138384 antibody, DWSU75E-15 antibody, DWSU75E 15 antibody, DWSU75E 15
Specificity D15WSU75E antibody was raised against the middle region of D15Wsu75E
Cross Reactivity Human
Applications WB
Immunogen D15WSU75E antibody was raised using the middle region of D15Wsu75E corresponding to a region with amino acids FLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQ
Assay Information D15WSU75E Blocking Peptide, catalog no. 33R-2991, is also available for use as a blocking control in assays to test for specificity of this D15WSU75E antibody


Western Blot analysis using D15WSU75E antibody (70R-3435)

D15WSU75E antibody (70R-3435) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of D15WSU75E antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of D15WSU75E protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using D15WSU75E antibody (70R-3435) | D15WSU75E antibody (70R-3435) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors