DAGLB antibody (70R-7486)

Rabbit polyclonal DAGLB antibody raised against the middle region of DAGLB

Synonyms Polyclonal DAGLB antibody, Anti-DAGLB antibody, FLJ33909 antibody, Diacylglycerol Lipase Beta antibody, DAGLBETA antibody, FLJ33624 antibody, KCCR13L antibody
Specificity DAGLB antibody was raised against the middle region of DAGLB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DAGLB antibody was raised using the middle region of DAGLB corresponding to a region with amino acids STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGS
Assay Information DAGLB Blocking Peptide, catalog no. 33R-8863, is also available for use as a blocking control in assays to test for specificity of this DAGLB antibody

Images

Western Blot analysis using DAGLB antibody (70R-7486)

DAGLB antibody (70R-7486) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DAGLB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DAGLB belongs to the AB hydrolase superfamily.It catalyzes the hydrolysis of diacylglycerol (DAG) to 2-arachidonoyl-glycerol (2-AG), the most abundant endocannabinoid in tissues. This protein is required for axonal growth during development and for retrograde synaptic signaling at mature synapses.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DAGLB antibody (70R-7486) | DAGLB antibody (70R-7486) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors