DAPP1 antibody (70R-3878)

Rabbit polyclonal DAPP1 antibody raised against the middle region of DAPP1

Synonyms Polyclonal DAPP1 antibody, Anti-DAPP1 antibody, BAM32 antibody, Dual Adaptor Of Phosphotyrosine And 3-Phosphoinositides antibody, DKFZp667E0716 antibody
Specificity DAPP1 antibody was raised against the middle region of DAPP1
Cross Reactivity Human
Applications WB
Immunogen DAPP1 antibody was raised using the middle region of DAPP1 corresponding to a region with amino acids KHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDD
Assay Information DAPP1 Blocking Peptide, catalog no. 33R-4412, is also available for use as a blocking control in assays to test for specificity of this DAPP1 antibody


Western Blot analysis using DAPP1 antibody (70R-3878)

DAPP1 antibody (70R-3878) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DAPP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DAPP1 may act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DAPP1 antibody (70R-3878) | DAPP1 antibody (70R-3878) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors