DAZ1 antibody (70R-4634)

Rabbit polyclonal DAZ1 antibody raised against the N terminal of DAZ1

Synonyms Polyclonal DAZ1 antibody, Anti-DAZ1 antibody, DAZ antibody, Deleted In Azoospermia 1 antibody, SPGY antibody
Specificity DAZ1 antibody was raised against the N terminal of DAZ1
Cross Reactivity Human
Applications WB
Immunogen DAZ1 antibody was raised using the N terminal of DAZ1 corresponding to a region with amino acids MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR
Assay Information DAZ1 Blocking Peptide, catalog no. 33R-6391, is also available for use as a blocking control in assays to test for specificity of this DAZ1 antibody


Western Blot analysis using DAZ1 antibody (70R-4634)

DAZ1 antibody (70R-4634) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DAZ1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DAZ1 is a RNA-binding protein that plays an essential role in spermatogenesis. DAZ1 may act by binding to the 3'-UTR of mRNAs and regulating their translation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DAZ1 antibody (70R-4634) | DAZ1 antibody (70R-4634) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors