DAZ2 antibody (70R-4896)

Rabbit polyclonal DAZ2 antibody raised against the N terminal of DAZ2

Synonyms Polyclonal DAZ2 antibody, Anti-DAZ2 antibody, Deleted In Azoospermia 2 antibody
Specificity DAZ2 antibody was raised against the N terminal of DAZ2
Cross Reactivity Human
Applications IHC, WB
Immunogen DAZ2 antibody was raised using the N terminal of DAZ2 corresponding to a region with amino acids MDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQ
Assay Information DAZ2 Blocking Peptide, catalog no. 33R-5830, is also available for use as a blocking control in assays to test for specificity of this DAZ2 antibody


Immunohistochemical staining using DAZ2 antibody (70R-4896)

DAZ2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DAZ2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DAZ2 is a member of the DAZ family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using DAZ2 antibody (70R-4896) | DAZ2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X
  • Western Blot analysis using DAZ2 antibody (70R-4896) | DAZ2 antibody (70R-4896) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors