DAZ3 antibody (70R-4845)

Rabbit polyclonal DAZ3 antibody raised against the middle region of DAZ3

Synonyms Polyclonal DAZ3 antibody, Anti-DAZ3 antibody, pDP1679 antibody, MGC126441 antibody, Deleted In Azoospermia 3 antibody
Specificity DAZ3 antibody was raised against the middle region of DAZ3
Cross Reactivity Human
Applications WB
Immunogen DAZ3 antibody was raised using the middle region of DAZ3 corresponding to a region with amino acids PFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAF
Assay Information DAZ3 Blocking Peptide, catalog no. 33R-7082, is also available for use as a blocking control in assays to test for specificity of this DAZ3 antibody


Western Blot analysis using DAZ3 antibody (70R-4845)

DAZ3 antibody (70R-4845) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DAZ3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DAZ3 antibody (70R-4845) | DAZ3 antibody (70R-4845) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors