DAZ4 antibody (70R-4894)

Rabbit polyclonal DAZ4 antibody raised against the middle region of DAZ4

Synonyms Polyclonal DAZ4 antibody, Anti-DAZ4 antibody, pDP1681 antibody, DAZ antibody, Deleted In Azoospermia 4 antibody, DAZ1 antibody, pDP1680 antibody
Specificity DAZ4 antibody was raised against the middle region of DAZ4
Cross Reactivity Human
Applications WB
Immunogen DAZ4 antibody was raised using the middle region of DAZ4 corresponding to a region with amino acids ITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTA
Assay Information DAZ4 Blocking Peptide, catalog no. 33R-4176, is also available for use as a blocking control in assays to test for specificity of this DAZ4 antibody


Western Blot analysis using DAZ4 antibody (70R-4894)

DAZ4 antibody (70R-4894) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DAZ4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DAZ4 antibody (70R-4894) | DAZ4 antibody (70R-4894) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors