DAZ4 antibody (70R-4895)

Rabbit polyclonal DAZ4 antibody raised against the N terminal of DAZ4

Synonyms Polyclonal DAZ4 antibody, Anti-DAZ4 antibody, Deleted In Azoospermia 4 antibody
Specificity DAZ4 antibody was raised against the N terminal of DAZ4
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen DAZ4 antibody was raised using the N terminal of DAZ4 corresponding to a region with amino acids MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR
Assay Information DAZ4 Blocking Peptide, catalog no. 33R-6390, is also available for use as a blocking control in assays to test for specificity of this DAZ4 antibody

Images

Immunohistochemical staining using DAZ4 antibody (70R-4895)

DAZ4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DAZ4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using DAZ4 antibody (70R-4895) | DAZ4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X.
  • Western Blot analysis using DAZ4 antibody (70R-4895) | DAZ4 antibody (70R-4895) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using DAZ4 antibody (70R-4895) | DAZ4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of fundic gland (arrows) in Human Stomach. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors