DAZL antibody (70R-4671)

Rabbit polyclonal DAZL antibody raised against the C terminal of DAZL

Synonyms Polyclonal DAZL antibody, Anti-DAZL antibody, Deleted In Azoospermia-Like antibody, MGC26406 antibody, DAZLA antibody, DAZH antibody, DAZL1 antibody, SPGYLA antibody
Specificity DAZL antibody was raised against the C terminal of DAZL
Cross Reactivity Human
Applications WB
Immunogen DAZL antibody was raised using the C terminal of DAZL corresponding to a region with amino acids EVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLR
Assay Information DAZL Blocking Peptide, catalog no. 33R-2778, is also available for use as a blocking control in assays to test for specificity of this DAZL antibody

Images

Western Blot analysis using DAZL antibody (70R-4671)

DAZL antibody (70R-4671) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DAZL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DAZ (Deleted in AZoospermia) is the potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DAZL antibody (70R-4671) | DAZL antibody (70R-4671) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors