DCC antibody (70R-4484)

Rabbit polyclonal DCC antibody raised against the middle region of DCC

Synonyms Polyclonal DCC antibody, Anti-DCC antibody, CRC18 antibody, Deleted In Colorectal Carcinoma antibody, CRCR1 antibody
Specificity DCC antibody was raised against the middle region of DCC
Cross Reactivity Human
Applications WB
Immunogen DCC antibody was raised using the middle region of DCC corresponding to a region with amino acids PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ
Assay Information DCC Blocking Peptide, catalog no. 33R-7153, is also available for use as a blocking control in assays to test for specificity of this DCC antibody

Images

Western Blot analysis using DCC antibody (70R-4484)

DCC antibody (70R-4484) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 158 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DCC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a netrin 1 receptor. The transmembrane protein is a member of the immunoglobulin superfamily of cell adhesion molecules, and mediates axon guidance of neuronal growth cones towards sources of netrin 1 ligand. The cytoplasmic tail interacts with the tyrosine kinases Src and focal adhesion kinase (FAK, also known as PTK2) to mediate axon attraction. The protein partially localizes to lipid rafts, and induces apoptosis in the absence of ligand. The protein functions as a tumor suppressor, and is frequently mutated or downregulated in colorectal cancer and esophageal carcinoma.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DCC antibody (70R-4484) | DCC antibody (70R-4484) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors