DCP2 antibody (70R-4870)

Rabbit polyclonal DCP2 antibody

Synonyms Polyclonal DCP2 antibody, Anti-DCP2 antibody, Dcp2 Decapping Enzyme Homolog antibody, DCP 2, FLJ33245 antibody, DCP2, DCP-2 antibody, NUDT20 antibody, DCP 2 antibody, DCP-2
Cross Reactivity Human
Applications WB
Immunogen DCP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGK
Assay Information DCP2 Blocking Peptide, catalog no. 33R-9500, is also available for use as a blocking control in assays to test for specificity of this DCP2 antibody

Images

Western Blot analysis using DCP2 antibody (70R-4870)

DCP2 antibody (70R-4870) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DCP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DCP2 is a key component of an mRNA-decapping complex required for removal of the 5-prime cap from mRNA prior to its degradation from the 5-prime end.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DCP2 antibody (70R-4870) | DCP2 antibody (70R-4870) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors