DCUN1D1 antibody (70R-3479)

Rabbit polyclonal DCUN1D1 antibody

Synonyms Polyclonal DCUN1D1 antibody, Anti-DCUN1D1 antibody, DCUN1, SCRO antibody, DCUN1L1 antibody, DCUN-1 antibody, DCUN-1, RP42 antibody, Dcn1 Defective In Cullin Neddylation 1 Domain Containing 1 antibody, DCUN 1, Tes3 antibody, DCUN 1 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen DCUN1D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENK
Assay Information DCUN1D1 Blocking Peptide, catalog no. 33R-8719, is also available for use as a blocking control in assays to test for specificity of this DCUN1D1 antibody

Images

Immunohistochemical staining using DCUN1D1 antibody (70R-3479)

DCUN1D1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DCUN1D1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DCUN1D1 may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using DCUN1D1 antibody (70R-3479) | DCUN1D1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using DCUN1D1 antibody (70R-3479) | DCUN1D1 antibody (70R-3479) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors