DCUN1D1 antibody (70R-3598)

Rabbit polyclonal DCUN1D1 antibody

Synonyms Polyclonal DCUN1D1 antibody, Anti-DCUN1D1 antibody, DCUN1, SCRO antibody, DCUN-1 antibody, DCUN 1, Dcn1 Defective In Cullin Neddylation 1 Domain Containing 1 antibody, DCUN 1 antibody, Tes3 antibody, DCUN1L1 antibody, DCUN-1, SCCRO antibody, RP42 antibody
Cross Reactivity Human
Applications WB
Immunogen DCUN1D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTT
Assay Information DCUN1D1 Blocking Peptide, catalog no. 33R-7165, is also available for use as a blocking control in assays to test for specificity of this DCUN1D1 antibody


Western Blot analysis using DCUN1D1 antibody (70R-3598)

DCUN1D1 antibody (70R-3598) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DCUN1D1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DCUN1D1 may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DCUN1D1 antibody (70R-3598) | DCUN1D1 antibody (70R-3598) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors