DCX antibody (70R-5901)

Rabbit polyclonal DCX antibody

Synonyms Polyclonal DCX antibody, Anti-DCX antibody, Doublecortin antibody, SCLH antibody, DBCN antibody, DC antibody, LISX antibody, Doublecortex; Lissencephaly X-Linked antibody, XLIS antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DCX antibody was raised using a synthetic peptide corresponding to a region with amino acids PEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRR
Assay Information DCX Blocking Peptide, catalog no. 33R-7047, is also available for use as a blocking control in assays to test for specificity of this DCX antibody


Western Blot analysis using DCX antibody (70R-5901)

DCX antibody (70R-5901) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DCX antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. DCX is a cytoplasmic protein which appears to direct neuronal migration by regulating the organization and stability of microtubules. The protein contains two doublecortin domains, which bind microtubules. In addition, DCX interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DCX antibody (70R-5901) | DCX antibody (70R-5901) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors