DCXR antibody (70R-3264)

Rabbit polyclonal DCXR antibody raised against the middle region of DCXR

Synonyms Polyclonal DCXR antibody, Anti-DCXR antibody, DCR antibody, Dicarbonyl/L-Xylulose Reductase antibody, HCRII antibody, P34H antibody, KIDCR antibody
Specificity DCXR antibody was raised against the middle region of DCXR
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen DCXR antibody was raised using the middle region of DCXR corresponding to a region with amino acids STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM
Assay Information DCXR Blocking Peptide, catalog no. 33R-8869, is also available for use as a blocking control in assays to test for specificity of this DCXR antibody

Images

Immunohistochemical staining using DCXR antibody (70R-3264)

DCXR antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DCXR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DCXR is an enzyme that has both diacetyl reductase and L-xylulose reductase activities.DCXR is an enzyme that has both diacetyl reductase (EC 1.1.1.5) and L-xylulose reductase (EC 1.1.1.10) activities.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using DCXR antibody (70R-3264) | DCXR antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using DCXR antibody (70R-3264) | DCXR antibody (70R-3264) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors