DDAH2 antibody (70R-5792)

Rabbit polyclonal DDAH2 antibody raised against the N terminal of DDAH2

Synonyms Polyclonal DDAH2 antibody, Anti-DDAH2 antibody, Dimethylarginine Dimethylaminohydrolase 2 antibody, NG30 antibody, DDAH antibody, DDAHII antibody, G6a antibody
Specificity DDAH2 antibody was raised against the N terminal of DDAH2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DDAH2 antibody was raised using the N terminal of DDAH2 corresponding to a region with amino acids MYTLHTKRVKAAARQMWTSNLSKVRQSLKNVYHKCKIRHQDSTGYPTVTS
Assay Information DDAH2 Blocking Peptide, catalog no. 33R-6631, is also available for use as a blocking control in assays to test for specificity of this DDAH2 antibody

Images

Immunohistochemical staining using DDAH2 antibody (70R-5792)

DDAH2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDAH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DDAH2 hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. DDAH2 has therefore a role in nitric oxide generation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using DDAH2 antibody (70R-5792) | DDAH2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using DDAH2 antibody (70R-5792) | DDAH2 antibody (70R-5792) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors