DDC antibody (70R-3369)

Rabbit polyclonal DDC antibody

Synonyms Polyclonal DDC antibody, Anti-DDC antibody, Dopa Decarboxylase antibody, AADC antibody, Aromatic L-Amino Acid Decarboxylase antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DDC antibody was raised using a synthetic peptide corresponding to a region with amino acids SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL
Assay Information DDC Blocking Peptide, catalog no. 33R-8603, is also available for use as a blocking control in assays to test for specificity of this DDC antibody


Western Blot analysis using DDC antibody (70R-3369)

DDC antibody (70R-3369) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DDC antibody (70R-3369) | DDC antibody (70R-3369) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors