DDHD2 antibody (70R-4082)

Rabbit polyclonal DDHD2 antibody raised against the N terminal of DDHD2

Synonyms Polyclonal DDHD2 antibody, Anti-DDHD2 antibody, SAMWD1 antibody, KIAA0725 antibody, Ddhd Domain Containing 2 antibody
Specificity DDHD2 antibody was raised against the N terminal of DDHD2
Cross Reactivity Human
Applications WB
Immunogen DDHD2 antibody was raised using the N terminal of DDHD2 corresponding to a region with amino acids DGWGSTPTEQGRPRTVKRGVENISVDIHCGEPLQIDHLVFVVHGIGPACD
Assay Information DDHD2 Blocking Peptide, catalog no. 33R-1971, is also available for use as a blocking control in assays to test for specificity of this DDHD2 antibody

Images

Western Blot analysis using DDHD2 antibody (70R-4082)

DDHD2 antibody (70R-4082) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDHD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DDHD2 is a phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine.DDHD2 may be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DDHD2 antibody (70R-4082) | DDHD2 antibody (70R-4082) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors