DDX23 antibody (70R-1383)

Rabbit polyclonal DDX23 antibody

Synonyms Polyclonal DDX23 antibody, Anti-DDX23 antibody, DDX 23 antibody, DDX 23, Dead antibody, DDX-23 antibody, DDX-23, DDX23, Asp-Glu-Ala-Asp Box Polypeptide 23 antibody
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen DDX23 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA
Assay Information DDX23 Blocking Peptide, catalog no. 33R-2328, is also available for use as a blocking control in assays to test for specificity of this DDX23 antibody


Western Blot analysis using DDX23 antibody (70R-1383)

DDX23 antibody (70R-1383) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 90 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of DDX23 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DDX23 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DDX23 antibody (70R-1383) | DDX23 antibody (70R-1383) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors