DDX47 Blocking Peptide (33R-1040)

A synthetic peptide for use as a blocking control in assays to test for specificity of DDX47 antibody, catalog no. 70R-4790

Synonyms DDX47 control peptide, DDX47 antibody Blocking Peptide, Anti-DDX47 Blocking Peptide, Dead Blocking Peptide, Asp-Glu-Ala-Asp Box Polypeptide 47 Blocking Peptide, DKFZp564O176 Blocking Peptide, E4-DBP Blocking Peptide, FLJ30012 Blocking Peptide, HQ0256 Blocking Peptide, MSTP162 Blocking Peptide, DDX47, DDX-47, DDX 47, DDX-47 Blocking Peptide, DDX 47 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQ
Molecular Weight 50 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DDX47 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors