DDX49 antibody (70R-1308)

Rabbit polyclonal DDX49 antibody

Synonyms Polyclonal DDX49 antibody, Anti-DDX49 antibody, DDX-49, DDX 49, Dead antibody, DDX-49 antibody, DDX49, DDX 49 antibody, Asp-Glu-Ala-Asp Box Polypeptide 49 antibody
Cross Reactivity Human,Mouse,Dog
Applications WB
Immunogen DDX49 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR
Assay Information DDX49 Blocking Peptide, catalog no. 33R-2530, is also available for use as a blocking control in assays to test for specificity of this DDX49 antibody

Images

Western Blot analysis using DDX49 antibody (70R-1308)

DDX49 antibody (70R-1308) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of DDX49 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Anti-DDX49 has not yet been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DDX49 antibody (70R-1308) | DDX49 antibody (70R-1308) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors