DDX50 antibody (70R-4785)

Rabbit polyclonal DDX50 antibody

Synonyms Polyclonal DDX50 antibody, Anti-DDX50 antibody, DDX 50, DDX50, Dead antibody, DDX 50 antibody, MGC3199 antibody, RH-II/GuB antibody, DDX-50 antibody, Asp-Glu-Ala-Asp Box Polypeptide 50 antibody, GU2 antibody, DDX-50, GUB antibody
Cross Reactivity Human
Applications WB
Immunogen DDX50 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYDSDEKSETRENG
Assay Information DDX50 Blocking Peptide, catalog no. 33R-7109, is also available for use as a blocking control in assays to test for specificity of this DDX50 antibody


Western Blot analysis using DDX50 antibody (70R-4785)

DDX50 antibody (70R-4785) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 82 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDX50 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX50 is a DEAD box enzyme that may be involved in ribosomal RNA synthesis or processing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DDX50 antibody (70R-4785) | DDX50 antibody (70R-4785) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors