DDX59 antibody (70R-4735)

Rabbit polyclonal DDX59 antibody

Synonyms Polyclonal DDX59 antibody, Anti-DDX59 antibody, DDX59, ZNHIT5 antibody, DDX 59 antibody, DDX-59 antibody, DDX-59, DDX 59, Asp-Glu-Ala-Asp Box Polypeptide 59 antibody, DKFZP564B1023 antibody, Dead antibody
Cross Reactivity Human
Applications WB
Immunogen DDX59 antibody was raised using a synthetic peptide corresponding to a region with amino acids PQKADSEPESPLNASYVYKEHPFILNLQEDQIENLKQQLGILVQGQEVTR
Assay Information DDX59 Blocking Peptide, catalog no. 33R-7302, is also available for use as a blocking control in assays to test for specificity of this DDX59 antibody


Western Blot analysis using DDX59 antibody (70R-4735)

DDX59 antibody (70R-4735) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDX59 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of DDX59 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DDX59 antibody (70R-4735) | DDX59 antibody (70R-4735) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors