Decorin antibody (70R-5367)

Rabbit polyclonal Decorin antibody raised against the N terminal of DCN

Synonyms Polyclonal Decorin antibody, Anti-Decorin antibody, PGS2 antibody, DSPG2 antibody, CSCD antibody, DCN antibody, PGII antibody, PG40 antibody, SLRR1B antibody
Specificity Decorin antibody was raised against the N terminal of DCN
Cross Reactivity Human,Dog
Applications WB
Immunogen Decorin antibody was raised using the N terminal of DCN corresponding to a region with amino acids IGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTL
Assay Information Decorin Blocking Peptide, catalog no. 33R-3977, is also available for use as a blocking control in assays to test for specificity of this Decorin antibody

Images

Western blot analysis using Decorin antibody (70R-5367)

Recommended DCN Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DCN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DCN is a small cellular or pericellular matrix proteoglycan that is closely related in structure to biglycan protein. This protein and biglycan are thought to be the result of a gene duplication. DCN is a component of connective tissue, binds to type I collagen fibrils, and plays a role in matrix assembly. It contains one attached glycosaminoglycan chain. This protein is capable of suppressing the growth of various tumor cell lines. There are multiple alternatively spliced transcript variants known for this gene. This gene is a candidate gene for Marfan syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using Decorin antibody (70R-5367) | Recommended DCN Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using Decorin antibody (70R-5367) | Skin

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors