DEGS1 antibody (70R-6850)

Rabbit polyclonal DEGS1 antibody

Synonyms Polyclonal DEGS1 antibody, Anti-DEGS1 antibody, FADS7 antibody, Degenerative Spermatocyte Homolog 1 Lipid Desaturase antibody, Des-1 antibody, DEGS antibody, DES1 antibody, MLD antibody, MIG15 antibody, MGC5079 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DEGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMV
Assay Information DEGS1 Blocking Peptide, catalog no. 33R-3584, is also available for use as a blocking control in assays to test for specificity of this DEGS1 antibody

Images

Western Blot analysis using DEGS1 antibody (70R-6850)

DEGS1 antibody (70R-6850) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DEGS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEGS1 is a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this protein inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DEGS1 antibody (70R-6850) | DEGS1 antibody (70R-6850) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors