DENND1B antibody (70R-7075)

Rabbit polyclonal DENND1B antibody raised against the N terminal of DENND1B

Synonyms Polyclonal DENND1B antibody, Anti-DENND1B antibody, Denn/Madd Domain Containing 1B antibody, MGC27044 antibody, FAM31B antibody
Specificity DENND1B antibody was raised against the N terminal of DENND1B
Cross Reactivity Human
Applications WB
Immunogen DENND1B antibody was raised using the N terminal of DENND1B corresponding to a region with amino acids YKLLNTLADYLAKELENDLNETLRSLYNHPVPKANTPVNLSVNQEIFIAC
Assay Information DENND1B Blocking Peptide, catalog no. 33R-10151, is also available for use as a blocking control in assays to test for specificity of this DENND1B antibody

Images

Western blot analysis using DENND1B antibody (70R-7075)

Recommended DENND1B Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DENND1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DENND1B contains 1 dDENN domain, 1 DENN domain and 1 uDENN domain. The function of the DENND1B protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using DENND1B antibody (70R-7075) | Recommended DENND1B Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors