DENND2C antibody (70R-3785)

Rabbit polyclonal DENND2C antibody raised against the middle region of DENND2C

Synonyms Polyclonal DENND2C antibody, Anti-DENND2C antibody, FLJ37099 antibody, Denn/Madd Domain Containing 2C antibody, DKFZp686N1631 antibody, DKFZp779P1149 antibody, DKFZp686G0351 antibody, RP5-1156J9.1 antibody, dJ1156J9.1 antibody
Specificity DENND2C antibody was raised against the middle region of DENND2C
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DENND2C antibody was raised using the middle region of DENND2C corresponding to a region with amino acids DIFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQL
Assay Information DENND2C Blocking Peptide, catalog no. 33R-1994, is also available for use as a blocking control in assays to test for specificity of this DENND2C antibody


Western Blot analysis using DENND2C antibody (70R-3785)

DENND2C antibody (70R-3785) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 100 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DENND2C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of DENND2C is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DENND2C antibody (70R-3785) | DENND2C antibody (70R-3785) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors