Desmocollin 3 antibody (70R-6132)

Rabbit polyclonal Desmocollin 3 antibody raised against the N terminal of DSC3

Synonyms Polyclonal Desmocollin 3 antibody, Anti-Desmocollin 3 antibody, HT-CP antibody, DSC4 antibody, DSC1 antibody, DSC2 antibody, DSC3 antibody, DSC antibody, CDHF3 antibody
Specificity Desmocollin 3 antibody was raised against the N terminal of DSC3
Cross Reactivity Human
Applications WB
Immunogen Desmocollin 3 antibody was raised using the N terminal of DSC3 corresponding to a region with amino acids MQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGVDKEPLNLFYIERDTG
Assay Information Desmocollin 3 Blocking Peptide, catalog no. 33R-6324, is also available for use as a blocking control in assays to test for specificity of this Desmocollin 3 antibody

Images

Western Blot analysis using Desmocollin 3 antibody (70R-6132)

Desmocollin 3 antibody (70R-6132) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 85 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DSC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DSC3 is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Desmocollin 3 antibody (70R-6132) | Desmocollin 3 antibody (70R-6132) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors