Destrin antibody (70R-3884)

Rabbit polyclonal Destrin antibody

Synonyms Polyclonal Destrin antibody, Anti-Destrin antibody, DSTN antibody, ACTDP antibody, bA462D18.2 antibody, Actin Depolymerizing Factor antibody, ADF antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Destrin antibody was raised using a synthetic peptide corresponding to a region with amino acids ASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEE
Assay Information Destrin Blocking Peptide, catalog no. 33R-1510, is also available for use as a blocking control in assays to test for specificity of this Destrin antibody

Images

Western Blot analysis using Destrin antibody (70R-3884)

Destrin antibody (70R-3884) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DSTN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DSTN belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. It is the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Destrin antibody (70R-3884) | Destrin antibody (70R-3884) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors