DFFB antibody (70R-5928)

Rabbit polyclonal DFFB antibody

Synonyms Polyclonal DFFB antibody, Anti-DFFB antibody, DFF2 antibody, CPAN antibody, CAD antibody, Dna Fragmentation Factor 40Kda Beta Polypeptide antibody, DFF-40 antibody, DFF40 antibody, Caspase-Activated Dnase antibody
Cross Reactivity Human
Applications WB
Immunogen DFFB antibody was raised using a synthetic peptide corresponding to a region with amino acids EYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRK
Assay Information DFFB Blocking Peptide, catalog no. 33R-2821, is also available for use as a blocking control in assays to test for specificity of this DFFB antibody

Images

Western Blot analysis using DFFB antibody (70R-5928)

DFFB antibody (70R-5928) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DFFB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DFFB is a nuclease that induces DNA fragmentation and chromatin condensation during apoptosis. DFFB degrades naked DNA and induces apoptotic morphology.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DFFB antibody (70R-5928) | DFFB antibody (70R-5928) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors