DGCR2 antibody (70R-6190)

Rabbit polyclonal DGCR2 antibody raised against the N terminal of DGCR2

Synonyms Polyclonal DGCR2 antibody, Anti-DGCR2 antibody, KIAA0163 antibody, DKFZp686I1730 antibody, SEZ-12 antibody, Digeorge Syndrome Critical Region Gene 2 antibody, IDD antibody, LAN antibody, DGS-C antibody
Specificity DGCR2 antibody was raised against the N terminal of DGCR2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DGCR2 antibody was raised using the N terminal of DGCR2 corresponding to a region with amino acids MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGTIQCIPLPWQ
Assay Information DGCR2 Blocking Peptide, catalog no. 33R-6598, is also available for use as a blocking control in assays to test for specificity of this DGCR2 antibody

Images

Western Blot analysis using DGCR2 antibody (70R-6190)

DGCR2 antibody (70R-6190) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DGCR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DGCR2 is the putative adhesion receptor that could be involved in cell-cell or cell-matrix interactions required for normal cell differentiation and migration.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DGCR2 antibody (70R-6190) | DGCR2 antibody (70R-6190) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors