DGKA antibody (70R-5806)

Rabbit polyclonal DGKA antibody raised against the N terminal of DGKA

Synonyms Polyclonal DGKA antibody, Anti-DGKA antibody, DAGK antibody, DAGK1 antibody, DGK-alpha antibody, MGC12821 antibody, MGC42356 antibody, Diacylglycerol Kinase Alpha 80Kda antibody
Specificity DGKA antibody was raised against the N terminal of DGKA
Cross Reactivity Human
Applications WB
Immunogen DGKA antibody was raised using the N terminal of DGKA corresponding to a region with amino acids EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL
Assay Information DGKA Blocking Peptide, catalog no. 33R-2431, is also available for use as a blocking control in assays to test for specificity of this DGKA antibody

Images

Western Blot analysis using DGKA antibody (70R-5806)

DGKA antibody (70R-5806) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 83 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DGKA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DGKA antibody (70R-5806) | DGKA antibody (70R-5806) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors