DGKE antibody (70R-5996)

Rabbit polyclonal DGKE antibody raised against the N terminal of DGKE

Synonyms Polyclonal DGKE antibody, Anti-DGKE antibody, Diacylglycerol Kinase Epsilon 64Kda antibody, DGK antibody, DAGK6 antibody
Specificity DGKE antibody was raised against the N terminal of DGKE
Cross Reactivity Human
Applications WB
Immunogen DGKE antibody was raised using the N terminal of DGKE corresponding to a region with amino acids EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR
Assay Information DGKE Blocking Peptide, catalog no. 33R-2256, is also available for use as a blocking control in assays to test for specificity of this DGKE antibody

Images

Western Blot analysis using DGKE antibody (70R-5996)

DGKE antibody (70R-5996) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DGKE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DGKE antibody (70R-5996) | DGKE antibody (70R-5996) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors