DGKH antibody (70R-5760)

Rabbit polyclonal DGKH antibody raised against the middle region of DGKH

Synonyms Polyclonal DGKH antibody, Anti-DGKH antibody, DKFZp761I1510 antibody, Diacylglycerol Kinase Eta antibody, DGKeta antibody
Specificity DGKH antibody was raised against the middle region of DGKH
Cross Reactivity Human
Applications WB
Immunogen DGKH antibody was raised using the middle region of DGKH corresponding to a region with amino acids EPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQT
Assay Information DGKH Blocking Peptide, catalog no. 33R-2623, is also available for use as a blocking control in assays to test for specificity of this DGKH antibody


Western Blot analysis using DGKH antibody (70R-5760)

DGKH antibody (70R-5760) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 135 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DGKH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DGKH is a member of the diacylglycerol kinase (DGK) enzyme family of proteins, specifically the type II DGK subfamily. Members of this family are involved in regulating the intracellular concentrations of diacylglycerol and phosphatidic acid.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DGKH antibody (70R-5760) | DGKH antibody (70R-5760) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors