DHCR24 antibody (70R-6265)

Rabbit polyclonal DHCR24 antibody raised against the N terminal of DHCR24

Synonyms Polyclonal DHCR24 antibody, Anti-DHCR24 antibody, SELADIN1 antibody, DHCR24, 24-Dehydrocholesterol Reductase antibody, DHCR-24, KIAA0018 antibody, Nbla03646 antibody, DHCR 24, DHCR 24 antibody, seladin-1 antibody, DHCR-24 antibody
Specificity DHCR24 antibody was raised against the N terminal of DHCR24
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DHCR24 antibody was raised using the N terminal of DHCR24 corresponding to a region with amino acids FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK
Assay Information DHCR24 Blocking Peptide, catalog no. 33R-2970, is also available for use as a blocking control in assays to test for specificity of this DHCR24 antibody

Images

Western Blot analysis using DHCR24 antibody (70R-6265)

DHCR24 antibody (70R-6265) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DHCR24 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DHCR24 is a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. The protein contains a leader sequence that directs it to the endoplasmic reticulum membrane. Missense mutations in this gene have been associated with desmosterolosis. Also, reduced expression of the gene occurs in the temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DHCR24 antibody (70R-6265) | DHCR24 antibody (70R-6265) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors