DHDH antibody (70R-4443)

Rabbit polyclonal DHDH antibody

Synonyms Polyclonal DHDH antibody, Anti-DHDH antibody, HUM2DD antibody, Dihydrodiol Dehydrogenase antibody
Cross Reactivity Human
Applications WB
Immunogen DHDH antibody was raised using a synthetic peptide corresponding to a region with amino acids PCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMK
Assay Information DHDH Blocking Peptide, catalog no. 33R-7003, is also available for use as a blocking control in assays to test for specificity of this DHDH antibody

Images

Western Blot analysis using DHDH antibody (70R-4443)

DHDH antibody (70R-4443) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DHDH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DHDH is an enzyme that belongs to the family of dihydrodiol dehydrogenases, which exist in multiple forms in mammalian tissues and are involved in the metabolism of xenobiotics and sugars. These enzymes catalyze the NADP1-linked oxidation of transdihydrodiols of aromatic hydrocarbons to corresponding catechols. This enzyme is a dimeric dihydrodiol dehydrogenase, and it differs from monomeric dihydrodiol dehydrogenases in its high substrate specificity for trans-dihydrodiols of aromatic hydrocarbons in the oxidative direction.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DHDH antibody (70R-4443) | DHDH antibody (70R-4443) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors