DHODH antibody (70R-6501)

Rabbit polyclonal DHODH antibody raised against the N terminal of DHODH

Synonyms Polyclonal DHODH antibody, Anti-DHODH antibody, DHOdehase antibody, Dihydroorotate Dehydrogenase antibody
Specificity DHODH antibody was raised against the N terminal of DHODH
Cross Reactivity Human
Applications WB
Immunogen DHODH antibody was raised using the N terminal of DHODH corresponding to a region with amino acids RFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLG
Assay Information DHODH Blocking Peptide, catalog no. 33R-7911, is also available for use as a blocking control in assays to test for specificity of this DHODH antibody


Western Blot analysis using DHODH antibody (70R-6501)

DHODH antibody (70R-6501) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DHODH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DHODH catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DHODH antibody (70R-6501) | DHODH antibody (70R-6501) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors