DHODH antibody (70R-6502)

Rabbit polyclonal DHODH antibody raised against the middle region of DHODH

Synonyms Polyclonal DHODH antibody, Anti-DHODH antibody, DHOdehase antibody, Dihydroorotate Dehydrogenase antibody
Specificity DHODH antibody was raised against the middle region of DHODH
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DHODH antibody was raised using the middle region of DHODH corresponding to a region with amino acids NLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAEL
Assay Information DHODH Blocking Peptide, catalog no. 33R-6758, is also available for use as a blocking control in assays to test for specificity of this DHODH antibody

Images

Western Blot analysis using DHODH antibody (70R-6502)

DHODH antibody (70R-6502) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DHODH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DHODH catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DHODH antibody (70R-6502) | DHODH antibody (70R-6502) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors