DHRS7B antibody (70R-7405)

Rabbit polyclonal DHRS7B antibody

Synonyms Polyclonal DHRS7B antibody, Anti-DHRS7B antibody, DHRSB-7, DHRSB-7 antibody, MGC8916 antibody, DHRSB 7 antibody, DKFZp566O084 antibody, Sdr Family Member 7B antibody, Dehydrogenase/Reductase antibody, DHRS7B, DHRSB 7, CGI-93 antibody
Cross Reactivity Human
Applications WB
Immunogen DHRS7B antibody was raised using a synthetic peptide corresponding to a region with amino acids QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTA
Assay Information DHRS7B Blocking Peptide, catalog no. 33R-7459, is also available for use as a blocking control in assays to test for specificity of this DHRS7B antibody

Images

Western Blot analysis using DHRS7B antibody (70R-7405)

DHRS7B antibody (70R-7405) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DHRS7B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DHRS7B antibody (70R-7405) | DHRS7B antibody (70R-7405) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors