DHX15 antibody (70R-4689)

Rabbit polyclonal DHX15 antibody

Synonyms Polyclonal DHX15 antibody, Anti-DHX15 antibody, PRP43 antibody, DHX-15, Asp-Glu-Ala-His Box Polypeptide 15 antibody, DDX15 antibody, DHX15, DHX 15 antibody, PrPp43p antibody, HRH2 antibody, Deah antibody, PRPF43 antibody, DBP1 antibody, DHX-15 antibody, DHX 15
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DHX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSF
Assay Information DHX15 Blocking Peptide, catalog no. 33R-3317, is also available for use as a blocking control in assays to test for specificity of this DHX15 antibody


Western Blot analysis using DHX15 antibody (70R-4689)

DHX15 antibody (70R-4689) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 91 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DHX15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DHX15 is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DHX15 antibody (70R-4689) | DHX15 antibody (70R-4689) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors