DHX16 antibody (70R-5647)

Rabbit polyclonal DHX16 antibody

Synonyms Polyclonal DHX16 antibody, Anti-DHX16 antibody, DHX-16, Asp-Glu-Ala-His Box Polypeptide 16 antibody, DHX 16, DHX-16 antibody, DHX 16 antibody, Deah antibody, DHX16
Cross Reactivity Human
Applications WB
Immunogen DHX16 antibody was raised using a synthetic peptide corresponding to a region with amino acids KYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPV
Assay Information DHX16 Blocking Peptide, catalog no. 33R-4749, is also available for use as a blocking control in assays to test for specificity of this DHX16 antibody

Images

Western Blot analysis using DHX16 antibody (70R-5647)

DHX16 antibody (70R-5647) used at 0.125 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 115 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DHX16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.125 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DHX16 antibody (70R-5647) | DHX16 antibody (70R-5647) used at 0.125 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors