DHX30 antibody (70R-4752)

Rabbit polyclonal DHX30 antibody

Synonyms Polyclonal DHX30 antibody, Anti-DHX30 antibody, DHX-30 antibody, DDX30 antibody, Deah antibody, DHX 30 antibody, FLJ11214 antibody, DHX-30, DHX30, Asp-Glu-Ala-His Box Polypeptide 30 antibody, KIAA0890 antibody, DHX 30
Cross Reactivity Human
Applications WB
Immunogen DHX30 antibody was raised using a synthetic peptide corresponding to a region with amino acids AESGMAPGGPGEGDGSLVNASRDLLKEFPQPKNLLNSVIGRALGISHAKD
Assay Information DHX30 Blocking Peptide, catalog no. 33R-1151, is also available for use as a blocking control in assays to test for specificity of this DHX30 antibody


Western Blot analysis using DHX30 antibody (70R-4752)

DHX30 antibody (70R-4752) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DHX30 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX30 is a member of this family.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DHX30 antibody (70R-4752) | DHX30 antibody (70R-4752) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors