DHX30 Blocking Peptide (33R-1048)

A synthetic peptide for use as a blocking control in assays to test for specificity of DHX30 antibody, catalog no. 70R-4794

Synonyms DHX30 control peptide, DHX30 antibody Blocking Peptide, Anti-DHX30 Blocking Peptide, Deah Blocking Peptide, Asp-Glu-Ala-His Box Polypeptide 30 Blocking Peptide, DDX30 Blocking Peptide, FLJ11214 Blocking Peptide, KIAA0890 Blocking Peptide, Ret-CoR Blocking Peptide, DHX30, DHX-30, DHX 30, DHX-30 Blocking Peptide, DHX 30 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLH
Molecular Weight 129 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX30 is a member of this family.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors