DHX32 antibody (70R-4796)

Rabbit polyclonal DHX32 antibody

Synonyms Polyclonal DHX32 antibody, Anti-DHX32 antibody, DDX32 antibody, DHX-32, Deah antibody, FLJ10889 antibody, DHX32, DHX 32, DHLP1 antibody, DHX 32 antibody, FLJ10694 antibody, DHX-32 antibody, Asp-Glu-Ala-His Box Polypeptide 32 antibody
Cross Reactivity Human
Applications WB
Immunogen DHX32 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSSR
Assay Information DHX32 Blocking Peptide, catalog no. 33R-2347, is also available for use as a blocking control in assays to test for specificity of this DHX32 antibody


Western Blot analysis using DHX32 antibody (70R-4796)

DHX32 antibody (70R-4796) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DHX32 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX32 is a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants, but the full length nature of one of the variants has not been defined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DHX32 antibody (70R-4796) | DHX32 antibody (70R-4796) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors