DHX34 antibody (70R-4754)

Rabbit polyclonal DHX34 antibody

Synonyms Polyclonal DHX34 antibody, Anti-DHX34 antibody, DHX-34, DHX-34 antibody, Deah antibody, KIAA0134 antibody, DDX34 antibody, HRH1 antibody, DHX 34 antibody, DHX34, DHX 34, Asp-Glu-Ala-His Box Polypeptide 34 antibody
Cross Reactivity Human
Applications WB
Immunogen DHX34 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGD
Assay Information DHX34 Blocking Peptide, catalog no. 33R-9728, is also available for use as a blocking control in assays to test for specificity of this DHX34 antibody

Images

Western Blot analysis using DHX34 antibody (70R-4754)

DHX34 antibody (70R-4754) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 97 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DHX34 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. It is mapped to the glioma 19q tumor suppressor region and is a tumor suppressor candidate gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DHX34 antibody (70R-4754) | DHX34 antibody (70R-4754) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors