DHX58 antibody (70R-4734)

Rabbit polyclonal DHX58 antibody

Synonyms Polyclonal DHX58 antibody, Anti-DHX58 antibody, Asp-Glu-X-His Box Polypeptide 58 antibody, Dexh antibody, DHX 58 antibody, DHX 58, LGP2 antibody, DHX58, D11LGP2 antibody, DHX-58 antibody, DHX-58, D11lgp2e antibody
Cross Reactivity Human
Applications WB
Immunogen DHX58 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM
Assay Information DHX58 Blocking Peptide, catalog no. 33R-1634, is also available for use as a blocking control in assays to test for specificity of this DHX58 antibody

Images

Western Blot analysis using DHX58 antibody (70R-4734)

DHX58 antibody (70R-4734) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DHX58 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DHX58 is the negative regulator of host innate immune defense against viruses. The repressor domain of DHX58 interacts with DDX58 and negatively regulates DDX58-mediated signaling.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DHX58 antibody (70R-4734) | DHX58 antibody (70R-4734) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors