DHX9 antibody (70R-4788)

Rabbit polyclonal DHX9 antibody

Synonyms Polyclonal DHX9 antibody, Anti-DHX9 antibody, LKP antibody, Asp-Glu-Ala-His Box Polypeptide 9 antibody, NDH II antibody, DHX 9, Deah antibody, DHX-9, DHX-9 antibody, DDX9 antibody, DHX9, RHA antibody, NDHII antibody, DHX 9 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen DHX9 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK
Assay Information DHX9 Blocking Peptide, catalog no. 33R-3397, is also available for use as a blocking control in assays to test for specificity of this DHX9 antibody


Immunohistochemical staining using DHX9 antibody (70R-4788)

DHX9 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of pancreatic acinus (arrows) in Human Pancreas. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 141 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DHX9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX9 is a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using DHX9 antibody (70R-4788) | DHX9 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of pancreatic acinus (arrows) in Human Pancreas. Magnification is at 400X
  • Western Blot analysis using DHX9 antibody (70R-4788) | DHX9 antibody (70R-4788) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors